"context" : "lia-deleted-state", LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); "message" : "2080718", ] "action" : "rerender" { ] "context" : "", { } ] ] "actions" : [ "parameters" : { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { Informationen dazu findet Ihr im Beitrag Paket-SMS-Trojaner, Kabel:  Ausfall des Senders Channel One Russia in Niedersachsen und Bremen, Nähere Informationen dazu findet Ihr im Eilmeldungsboard. ;(function($) { { ] "displaySubject" : "true", "action" : "rerender" if ( count == neededkeys.length ) { { ] "linkDisabled" : "false" $(document).ready(function(){ "componentId" : "kudos.widget.button", "context" : "envParam:entity", "event" : "ProductAnswer", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { { { } }, "event" : "MessagesWidgetEditAction", "actions" : [ "context" : "", })(LITHIUM.jQuery); { }, "eventActions" : [ { "event" : "approveMessage", "action" : "rerender" { "action" : "rerender" "event" : "MessagesWidgetMessageEdit", })(LITHIUM.jQuery); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2081049 .lia-rating-control-passive', '#form_4'); { } "actions" : [ { "event" : "ProductMessageEdit", } { { "context" : "", ] } "context" : "", "actions" : [ }, { $('div[class*="-menu-btn"]').removeClass('active'); { } "actions" : [ "disallowZeroCount" : "false", "context" : "", { ], "actions" : [ "action" : "rerender" } $('#vodafone-community-header').toggle(); "componentId" : "kudos.widget.button", { }); "event" : "unapproveMessage", "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ "event" : "MessagesWidgetCommentForm", Die Senderlisten für Giga TV, haben mit dem TV Empfang über DSL nichts zu tun. })(LITHIUM.jQuery); "displaySubject" : "true", if ( neededkeys[count] == key ) { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] "actions" : [ { "closeImageIconURL" : "https://forum.vodafone.de/skins/images/BBFF12047EF7A59675C23B982ACFB732/responsive_peak/images/button_dialog_close.svg", ] { } "includeRepliesModerationState" : "false", { }, "event" : "MessagesWidgetMessageEdit", { "actions" : [ ] { { "actions" : [ { "action" : "rerender" Im Kabelnetz von Vodafone und Unitymedia wird VoxUp ebenfalls ausgestrahlt (Unitymedia auf dem Kanalplatz 511). "closeEvent" : "LITHIUM:lightboxCloseEvent", }, "actions" : [ "actions" : [ "actions" : [ "actions" : [ "context" : "envParam:selectedMessage", { // We're good so far. }, }, "actions" : [ "context" : "", { $(document).ready(function(){ { LITHIUM.Loader.runJsAttached(); "displaySubject" : "true", { }, "action" : "rerender" "context" : "", }, watching = false; } "context" : "", }); element.find('ul').slideUp(); }, } { "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2175965,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "showCountOnly" : "false", } "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ] ] "actions" : [ "event" : "addMessageUserEmailSubscription", }, ] { "actions" : [ SAT.1 stammt aus dem Land Deutschland und ist empfangbar über Astra 19.2° Ost auf der Frequenz 12545 MHz H. SAT.1 frei empfangbar. }); "action" : "addClassName" "parameters" : { }, "action" : "rerender" watching = false; "event" : "MessagesWidgetMessageEdit", ] "context" : "", "defaultAriaLabel" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ { } "action" : "rerender" "context" : "envParam:quiltName", ] "accessibility" : false, }, }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'yRnupMp8WHLEm7ODK3jjj7M_ckGle641eDo1qXj5zbM. "event" : "ProductAnswer", ] { "useSimpleView" : "false", { "action" : "rerender" else { }, }, $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); "context" : "envParam:quiltName,expandedQuiltName", "action" : "pulsate" "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" "event" : "removeMessageUserEmailSubscription", "context" : "", ] ] { ], } }, { Ob das in Zukunft noch passiert, wissen auch wir vorab nicht. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "showCountOnly" : "false", } "context" : "envParam:quiltName", "event" : "markAsSpamWithoutRedirect", "action" : "rerender" ] "actions" : [ "actions" : [ }, "actions" : [ { } }, ] { { "event" : "approveMessage", ] { ], { "initiatorBinding" : true, "context" : "envParam:feedbackData", { "action" : "rerender" } $(document).ready(function(){ }, LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; { "context" : "", "action" : "rerender" }, "event" : "AcceptSolutionAction", "actions" : [ "action" : "rerender" }, { "event" : "deleteMessage", ] "}); "context" : "envParam:quiltName,product,contextId,contextUrl", }); { "context" : "envParam:entity", "actions" : [ { { { } } ] "actions" : [ Seit dem 1. "action" : "rerender" } ] "actions" : [ watching = false; Vodafone TV Cable) oder einem Kompletttarif für Internet. "context" : "envParam:entity", }, var keycodes = { }, ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); "selector" : "#kudosButtonV2_0", "context" : "", ] ', 'ajax'); "parameters" : { "event" : "deleteMessage", ] { { ] "event" : "MessagesWidgetEditCommentForm", "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); $(document).ready(function(){ "action" : "rerender" "activecastFullscreen" : false, } "event" : "unapproveMessage", "useSimpleView" : "false", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); Bist du sicher, dass du fortfahren möchtest? }; "action" : "pulsate" "selector" : "#messageview_3", { "event" : "QuickReply", "context" : "", }, "selector" : "#messageview_4", ] "kudosable" : "true", { }, "disallowZeroCount" : "false", "componentId" : "kudos.widget.button", "context" : "envParam:quiltName,message,product,contextId,contextUrl", { }, } }, { }, } LITHIUM.AjaxSupport.ComponentEvents.set({ ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ "actions" : [ "event" : "MessagesWidgetEditAction", "actions" : [ } "context" : "envParam:quiltName,expandedQuiltName", "displaySubject" : "true", { } }); }, ] } "event" : "RevokeSolutionAction", { "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" expireDate.setDate(expireDate.getDate() + 365*10); "context" : "envParam:quiltName,message", ] "context" : "", setCookie: function(cookieName, cookieValue) { "action" : "rerender" } LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.Dialog.options['1696815473'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; }, "context" : "", "context" : "envParam:quiltName,product,contextId,contextUrl", ] { } "selector" : "#kudosButtonV2_5", }, "context" : "", ] "event" : "removeMessageUserEmailSubscription", { "context" : "", { "action" : "rerender" { } }, { // We're good so far. LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "actions" : [ "context" : "", { ] "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/1234567/thread-id/40430","ajaxErrorEventName":"LITHIUM:ajaxError","token":"syC3HCPbpyK8YY4C0sOvg72zwEHUuRCoPhFNEFr5-Q8. { { LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }); ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2081049 .lia-rating-control-passive', '#form_4'); "context" : "envParam:feedbackData", "actions" : [ "event" : "MessagesWidgetEditCommentForm", "context" : "", } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/1234567/thread-id/40430","ajaxErrorEventName":"LITHIUM:ajaxError","token":"bxJhd0PSRR3VXXElCY9ortEd87x9d1qlK7cKF5aFdho. }, }, ] } "action" : "rerender" "actions" : [ { "action" : "rerender" } "event" : "MessagesWidgetCommentForm", { "context" : "", "revokeMode" : "true", CookieManager = { "action" : "rerender" { "kudosable" : "true", { "displayStyle" : "horizontal", "disallowZeroCount" : "false", "context" : "", "context" : "", "event" : "kudoEntity", }); count++; 1 Aussagen bewerten. }, LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } ] { "actions" : [ "parameters" : { "action" : "rerender" "}); "event" : "MessagesWidgetMessageEdit", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } } } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "showCountOnly" : "false", "message" : "2080719", }, { ] }, } "action" : "rerender" ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); }, return; { "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "action" : "rerender" } LITHIUM.AjaxSupport.ComponentEvents.set({ ] } } }, { "actions" : [ window.location.replace('/t5/user/userloginpage'); } { { "event" : "addMessageUserEmailSubscription", LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ] "actions" : [ "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_1babac05cb1ca4","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_1babac05cb1ca4_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/1234567/thread-id/40430&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"O50L1iBvPL2rN66f8ab8IMQLf95-xxpW2121r_TOQLU. "actions" : [ "action" : "pulsate" "event" : "removeThreadUserEmailSubscription", "action" : "pulsate" { { $(document).ready(function(){ "action" : "rerender" "event" : "kudoEntity", { "initiatorBinding" : true, "action" : "rerender" { "eventActions" : [ }); { } }); ] "event" : "removeMessageUserEmailSubscription", "componentId" : "kudos.widget.button", "initiatorDataMatcher" : "data-lia-kudos-id" { }); } }); Bist du sicher, dass du fortfahren möchtest? "kudosable" : "true", "actions" : [ Execute whatever should happen when entering the right sequence "buttonDialogCloseAlt" : "Schließen", { { "context" : "envParam:quiltName", }, "showCountOnly" : "false", { { { // We're good so far. { }); })(LITHIUM.jQuery); "actions" : [ "context" : "envParam:feedbackData", ] "disableLabelLinks" : "false", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { "context" : "envParam:quiltName,message", }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "editProductMessage", }); ] { if ( watching ) { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "displaySubject" : "true", "action" : "rerender" "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); { "actions" : [ Außerdem ist der Sender im MagentaTV … "action" : "rerender" { ] "action" : "rerender" "truncateBody" : "true", LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); } "event" : "MessagesWidgetEditAnswerForm", { "event" : "RevokeSolutionAction", })(LITHIUM.jQuery); } "event" : "removeMessageUserEmailSubscription", "actions" : [ "; { }, LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); } Bist du sicher, dass du fortfahren möchtest? "disableLinks" : "false", "quiltName" : "ForumMessage", if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { ] { LITHIUM.AjaxSupport.ComponentEvents.set({ "useTruncatedSubject" : "true", } } { "forceSearchRequestParameterForBlurbBuilder" : "false", } })(LITHIUM.jQuery); // Pull in global jQuery reference { "quiltName" : "ForumMessage", }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } } }, })(LITHIUM.jQuery); "event" : "ProductMessageEdit", }, // We made it! ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" { "event" : "expandMessage", } "event" : "QuickReply", "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ "disallowZeroCount" : "false", } else { "selector" : "#kudosButtonV2_4", } return; { "action" : "rerender" "useTruncatedSubject" : "true", //$(window).scroll(function() { { LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); return; { { // Oops, not the right sequence, lets restart from the top. { "action" : "addClassName" }, var key = e.keyCode; "actions" : [ { } "event" : "ProductAnswer", "event" : "deleteMessage", "event" : "deleteMessage", { ] "context" : "envParam:feedbackData", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); "action" : "rerender" "disableLinks" : "false", }, ] { "context" : "envParam:quiltName", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); }); "event" : "expandMessage", "action" : "rerender" { "actions" : [ { "context" : "", ] } "actions" : [ }, "actions" : [ "message" : "2081049", ] ] { "action" : "rerender" { { }, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); "selector" : "#messageview_5", "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/1234567/thread-id/40430","ajaxErrorEventName":"LITHIUM:ajaxError","token":"g1FwQLYz3yIH8TAv0JyvQdLcVtvWhC3DybmX5PJ4zr0. LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'saOc3_K3fJB1lxevlZWfhQUnz-72X_tFvwH4G7Wyffg. } }, Diese Vergütung trägt dazu bei, der hier integrierte Werbelink ist ein Vorschlag und stellt weitere Informationen zur Verfügung. "forceSearchRequestParameterForBlurbBuilder" : "false", "event" : "deleteMessage", { "disableLinks" : "false", }, "context" : "", "actions" : [ "actions" : [ }, "event" : "unapproveMessage", Bist du sicher, dass du fortfahren möchtest? { { Vielen Dank für die Antwort! "action" : "rerender" { "useCountToKudo" : "false", { } { $('.js-close-header-announcement').on('click', clickHandler); }, Execute whatever should happen when entering the right sequence { "componentId" : "forums.widget.message-view", }, }, }, }, "useCountToKudo" : "false", $(this).next().toggle(); } }, "action" : "rerender" "displayStyle" : "horizontal", "actions" : [ { LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ] "action" : "rerender" }, count++; "actions" : [ "event" : "MessagesWidgetEditAnswerForm", "actions" : [ "event" : "kudoEntity", } "disableKudosForAnonUser" : "false", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", element.siblings('li').find('ul').slideUp(); } "selector" : "#kudosButtonV2_2", "context" : "", "useCountToKudo" : "false", { "event" : "MessagesWidgetMessageEdit", "action" : "rerender" } { "action" : "rerender" "action" : "rerender" "initiatorBinding" : true, ], }, { "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ], "event" : "addThreadUserEmailSubscription", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName,product,contextId,contextUrl", } { "actions" : [ "actions" : [ }); element.removeClass('active'); { "actions" : [ LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "entity" : "2175965", ] } watching = false; "actions" : [ "event" : "kudoEntity", "action" : "pulsate" LITHIUM.AjaxSupport.useTickets = false; ] "actions" : [ "event" : "removeThreadUserEmailSubscription", "activecastFullscreen" : false, "action" : "rerender" } $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); "action" : "rerender" "kudosable" : "true", "action" : "rerender" }, ] "triggerSelector" : ".lia-panel-dialog-trigger-event-click", } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/1234567/thread-id/40430","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Vo5soBtQ4bRCJBv7waFSYkjM6Uy4mRwf3AGc_Z1TDhY. "event" : "approveMessage", "actions" : [ "context" : "envParam:selectedMessage", ] "truncateBodyRetainsHtml" : "false", "actions" : [ document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); "useTruncatedSubject" : "true", { "context" : "envParam:selectedMessage", ] LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "initiatorDataMatcher" : "data-lia-message-uid" ] "actions" : [ { ] "showCountOnly" : "false", { { "action" : "rerender" ;(function($) { "action" : "rerender" "kudosLinksDisabled" : "false", "actions" : [ $(this).addClass('active') ] Weitere Infos zum Empfang finden Sie hier: VOXup können Sie mit der Suchfunktion Ihrer TV-Fernbedienung finden. "event" : "addMessageUserEmailSubscription", }); { { ] }, { } "event" : "ProductMessageEdit", }, ] "quiltName" : "ForumMessage", }, "initiatorBinding" : true, ] } { } { "event" : "MessagesWidgetEditCommentForm", "event" : "addMessageUserEmailSubscription", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { ] ] "actions" : [ $('.menu-container').on('click','.community-user-menu-btn:not(.active)', {'selector' : '.css-user-menu'}, handleOpen); ;(function($) { Bist du sicher, dass du fortfahren möchtest? "actions" : [ } ], "context" : "envParam:quiltName", { "event" : "unapproveMessage", }, "context" : "", { ', 'ajax'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); ] Bist du sicher, dass du fortfahren möchtest? var ctaHTML = '. "actions" : [ "event" : "ProductAnswer", } { { "actions" : [ $('.css-menu').removeClass('cssmenu-open') "actions" : [ "kudosLinksDisabled" : "false", { "actions" : [ "event" : "addMessageUserEmailSubscription", "action" : "rerender" }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { LITHIUM.AjaxSupport.ComponentEvents.set({ { { "componentId" : "forums.widget.message-view", "action" : "rerender" "context" : "",