}, "context" : "lia-deleted-state", "action" : "pulsate" } }, "context" : "envParam:entity", "event" : "MessagesWidgetEditAction", { } }); { ] "action" : "rerender" ], } "includeRepliesModerationState" : "false", LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "kudosable" : "true", "context" : "envParam:feedbackData", ] ] "eventActions" : [ return; }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1594351 .lia-rating-control-passive', '#form_4'); { return; } { { "actions" : [ "actions" : [ }); "disableKudosForAnonUser" : "false", "parameters" : { "linkDisabled" : "false" // console.log(key); "includeRepliesModerationState" : "false", $('#custom-overall-notif-count').html(notifCount); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", "event" : "ProductAnswer", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); { { "actions" : [ ] // If watching, pay attention to key presses, looking for right sequence. "eventActions" : [ { { { LITHIUM.AjaxSupport.ComponentEvents.set({ "disableKudosForAnonUser" : "false", }, "}); } "truncateBodyRetainsHtml" : "false", { "actions" : [ } "context" : "", }); { "useSimpleView" : "false", "event" : "MessagesWidgetEditAnswerForm", } "actions" : [ { "action" : "rerender" $(document).ready(function(){ "context" : "", { ] "context" : "lia-deleted-state", LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { Bist du sicher, dass du fortfahren möchtest? LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "action" : "rerender" ] ] "context" : "envParam:quiltName", LITHIUM.Loader.runJsAttached(); "event" : "addThreadUserEmailSubscription", }, if ( neededkeys[count] == key ) { } "event" : "MessagesWidgetEditAction", "actions" : [ { }, Callya Vertrag kündigen rufnummernmitnahme. ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_CallYa/thread-id/43476","ajaxErrorEventName":"LITHIUM:ajaxError","token":"8nkawX5IvGj9KUA0sedTmBay_AMB6mr9zR67ZUcAzt0. } \\n\\t\\t\\t\\t\\t\\tDer gewünschte Vorgang konnte leider nicht abgeschlossen werden.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_721b55fe0b72fd', 'disableAutoComplete', '#ajaxfeedback_721b55fde6acb5_0', 'LITHIUM:ajaxError', {}, 'JPtzhJyAYVNAOsUC7VWzNUiBQPe8SjOgDl5X7nmYW7o. "entity" : "1594392", { "useSimpleView" : "false", }, if ( neededkeys[count] == key ) { "actions" : [ }); } "action" : "rerender" return; "context" : "", "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101001101" count = 0; "actions" : [ "action" : "rerender" } ] "context" : "envParam:quiltName", })(LITHIUM.jQuery); "actions" : [ "useCountToKudo" : "false", "actions" : [ "actions" : [ { { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] } "kudosable" : "true", ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ Wir prüfen die Adresse von Vodafone Prepaid regelmäßig, damit deine Kündigung sicher ankommt. "eventActions" : [ "action" : "addClassName" "initiatorDataMatcher" : "data-lia-kudos-id" { ', 'ajax'); "actions" : [ LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "action" : "rerender" "initiatorBinding" : true, "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" { ], }, "action" : "rerender" ] "action" : "rerender" { "actions" : [ }, { "context" : "envParam:feedbackData", "event" : "MessagesWidgetMessageEdit", // We're good so far. { "context" : "", }, "message" : "1594259", } "action" : "addClassName" { "actions" : [ // Oops. } "actions" : [ } ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { ] "initiatorBinding" : true, "event" : "ProductAnswer", LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'lB4pnL_-j15wbqSoTsR4i769CzfbEk1KdRk9jO1xlJk. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" "parameters" : { "initiatorBinding" : true, "actions" : [ ] { "event" : "expandMessage", "event" : "addMessageUserEmailSubscription", }, ] } "event" : "MessagesWidgetEditAnswerForm", } return; "kudosable" : "true", "event" : "QuickReply", LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); }); { Geht das, einfach die Karte auflanden und ohne diese Tarife, Optionen, usw. ] "event" : "ProductAnswerComment", "initiatorDataMatcher" : "data-lia-message-uid" "context" : "", ] LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); }, "componentId" : "kudos.widget.button", "dialogKey" : "dialogKey" } "context" : "", } }); { "event" : "ProductMessageEdit", 1. { LITHIUM.Dialog.options['876802581'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "linkDisabled" : "false" ] }, ', 'ajax'); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ "actions" : [ LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { { ] "context" : "envParam:selectedMessage", "context" : "envParam:quiltName,message", "forceSearchRequestParameterForBlurbBuilder" : "false", { "initiatorBinding" : true, "actions" : [ } "event" : "deleteMessage", { }); ] "actions" : [ { "actions" : [ "kudosLinksDisabled" : "false", { ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "event" : "MessagesWidgetEditCommentForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); ] } "actions" : [ } } "action" : "rerender" count++; "action" : "rerender" "initiatorDataMatcher" : "data-lia-kudos-id" LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234226}); element.find('ul').slideUp(); LITHIUM.Dialog.options['-1644067994'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "displaySubject" : "true", ] "event" : "removeThreadUserEmailSubscription", resetMenu(); "action" : "rerender" "action" : "rerender" "actions" : [ ] ] $(document).ready(function(){ } { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "initiatorBinding" : true, "context" : "", { "actions" : [ }, "context" : "envParam:feedbackData", "event" : "unapproveMessage",